sermorelin ghrp 6 results

Brand Name:Keray

Model Number:86168-78-7

Place of Origin:China

... Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate 2. Description: Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid

Brand Name:Saichuang

Model Number:87616-84-0

Place of Origin:China

... 99% min Usage Peptides; Hormones and Regulation of Endocrine Function of D Appearance White powder Property GHRP-6, GHRP-2, GHRP2, GHRP6, ghrp HGH fragment177-191, HGH fragment 176-191AOD, EGF, MT-1, MT-2,

Brand Name:YIHAN

Model Number:GHRP-2

Place of Origin:China

... Growth Hormone Peptide Pralmorelin benefits cycle dosage Quick Detail GHRP-2 (Pralmorelin) sterile lyophilized Peptide finished in 10mg/vial Description GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 CAS: 158861...

Brand Name:SMQ

Model Number:GHRP-2

Place of Origin:China mainland

... Growth Hormone Peptide Pralmorelin benefits cycle dosage Quick Detail GHRP-2 (Pralmorelin) sterile lyophilized Peptide finished in 10mg/vial Description GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 CAS: 158861...

Brand Name:TINGYI

Model Number:CAS: 86168-78-7

Place of Origin:CHINA

...98% High Purity Bio-identical Growth Hormone Peptide Sermorelin (2 mg/vial) Description: Sermorelin (INN) (trade name is Geref), also known as GHRH (1-29), is a growth hormone- releasing hormone (...

Brand Name:shinrezing

Model Number:87616-84-0

Place of Origin:China

...Name;GHRP-6 Ghrp-6 Chemical Name;Growth hormon releasing peptide-6 Ghrp-6 CAS Number;87616-84-0 Ghrp-6 Molecular Formula;C46H56N12O6 Ghrp-6 Molecular Weight; 873.01 Ghrp-6 specification;5mg/vail or 10mg/vail *10vial/kit Ghrp-6 Assay;99.5% Ghrp-6 Appearance...

Brand Name:bodybiological

Model Number:158861-67-7

Place of Origin:Hubei, China

...Research Chemical 99% Purity CAS158861-67-7 Peptides Ghrp 6 10mg/vial Basic Information for GHRP-6: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar Mass: 873.014 ...

Brand Name:Top Pharm

Model Number:87616-84-0

Place of Origin:China

... for gaining muscles CAS number: 87616-84-0 2mg/vial white powder Product Name GHRP-6 Acetate Sequence Cas No. 87616-84-0 Molecular Formula C46H56N12O6 Molecular Weight 873.01 Purity (HPLC) ...

Brand Name:FILTER

Model Number:158861-67-7

Place of Origin:China

...Raw Material Peptide Powder CAS 158861-67-7 Ghrp-6 for Fat Loss Description Alias GHRP-2 Acetate; (DES-ALA3)-GROWTH E-RELEASING PEPTIDE-2 CAS 158861-67-7 M.F C45H55N9O6 M.W 818.0 Purity 99%min Appearance ...

Brand Name:YC

Model Number:GHRP-6

Place of Origin:China

...99.9% Purity GHRP6 Human Growth Hormmone Polypeptide GHRP -6 5mg / vial Description of Ghrp6: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar Mass: 873.014 ...

Brand Name:SGH

Model Number:86168-78-7

Place of Origin:China

...- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino...

Brand Name:YIHAN

Model Number:Sermorelin 2mg

Place of Origin:CHINA

...Lyophilized Powder Sermorelin 2mg for Body Building CAS 86168-78-7 Quick detail: Product Name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GROWTH HOR RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78...

Brand Name:Holybiological

Model Number:WhatsApp:+8613545014917

Place of Origin:China

...Nature Fat Loss and Anti Aging Polypeptide Hormones Ghrp-2 Growth Hormone Releasing Peptide Ghrp-2 Name GHRP-2 (Pralmorelin) (5mg/vial,10vials/kit) Other name GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 Appearance White powder...

Brand Name:Pharma Grade

Model Number:86168-78-7

Place of Origin:Zhejiang,China

...Sermorelin CAS86168-78-7 human growth Peptides for Muscle growth Polypeptides are compounds in which alpha-amino ...

Brand Name:Peptides GHRP-2

Model Number:Peptides GHRP-2

Place of Origin:China

...Basic Info: Product name: GHRP-2 (GHRP-2 Acetate ) Synonym: Pralmorelin [INN]; D-Alanyl-3-(2-naphthalenyl)-D-alanyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide; GHRP 2; CAS: 158861-67-7 MF: C45H55N9O6 MW: 817.9749 Purity: 98% Appearance: White powder...

Brand Name:BestSteroid

Model Number:158861-67-7

Place of Origin:Hubei,China

... Releasing Peptide For Muscle Gain and Anti Aging GHRP-2 Basic Info GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate CAS: 158861-67-7 M.F.: C42H50N8O5 M.W.: 746.90 Purity (HPLC): 99.0%min. Appearance: White powder Single ...

Brand Name:Hongxi Pharm

Model Number:Sermorelin

Place of Origin:HongKong

...High Purity Peptide Growth Hormone Sermorelin for Muscle Growth Bodybuilding CAS 86168-78-7 Lyophilized Powder Quick Details: Product Name: Sermorelin Alias: Somatoliberin,Sermorelin CAS: 86168-78-7 EINECS: - Assay: 99% MF: C149H246N44O42S MW: 3357...

Brand Name:TY-Chemical

Model Number:87616-84-0

Place of Origin:China

... Top Pure Muscle Building Injection Our Safe through Customs Strengths: 1.Making sure GHRP-6 how is going to pass customs? GHRP-6 how to safely pass the customs problem, you don't have to worry...

Brand Name:RAWSGEAR

Model Number:86168-78-7

Place of Origin:China

...Weight loss Steroids Polypeptide Hormones Sermorelin Powder CAS 86168-78-7 Product name Sermorelin CAS No. 86168-78-7 MF C149H246N44O42S MW 3357.88 EINECS 1312995-182-4 storage temp −20°C Sermorelin is a GHRH (releasing hormone...

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was...